PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678456532
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family BES1
Protein Properties Length: 336aa    MW: 36123.4 Da    PI: 8.8938
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678456532genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822211.91.6e-65271551130
     DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                g+++rkp+w+ErEnn+rRERrRRaiaakiyaGLRaqGny+lpk++DnneVlkALc+eAGwvve+DGttyrkg+kp    e++g+ a+++p+ss + s+ s
  678456532  27 GAARRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEPDGTTYRKGCKPS-LIEIGGTPANITPSSSRNPSPPS 125
                689************************************************************************9.9********************** PP

     DUF822 101 salaspvesysaspksssfpspssldsisl 130
                s++asp++sy++sp+sssfpsps+ d + +
  678456532 126 SYFASPIPSYQPSPSSSSFPSPSRHDPAAN 155
                ************************998755 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.2E-6129153IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MIWEAGGSTT SSAEGGGGGA GGVIGGGAAR RKPSWREREN NRRRERRRRA IAAKIYAGLR  60
AQGNYNLPKH CDNNEVLKAL CAEAGWVVEP DGTTYRKGCK PSLIEIGGTP ANITPSSSRN  120
PSPPSSYFAS PIPSYQPSPS SSSFPSPSRH DPAANGLSHP FEFLSSLPST FQPLRISNSA  180
PVTPPLSSPR KLPKQTINLE LEALAKESIT SFNGPFFAVS APTSPVRVQR FTPITIPECD  240
ESDTSSTIDS GHWMNFQAYA NPPTAIPTSP MFNLMRPVPR AVPSQETAAA MADHDKGKSK  300
EFNFLNVAVK PWEGERIHDV GMDDLELTLS SGNTHV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12948RRKPSWRERENNRRRERRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767052.11e-134PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-107BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLQ94ET31e-123Q94ET3_SOLLC; Mature anther-specific protein LAT61
TrEMBLA0A068UH771e-123A0A068UH77_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-122(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-96BES1 family protein